PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_AFBE29C20.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 266aa    MW: 28685.9 Da    PI: 9.5458
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_AFBE29C20.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.63.8e-32170226158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            +ep+YVNaKQy++Il+RRq+Rak+e e+k  +k+rkpylheSRh+hA+rR+Rg+gGrF
  Traes_4DS_AFBE29C20.2 170 EEPVYVNAKQYHGILRRRQSRAKAELERKA-IKARKPYLHESRHQHAMRRARGTGGRF 226
                            69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.2E-36168229IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039169229IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.2E-27171226IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.7E-25172194IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860174194IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.7E-25203226IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSGMGSRPGE SNLVEPRGLP SAGMAMQPWW TGTGFGAVSP AVVAPGSGAG ISLSSNPFGG  60
GAPQGKKKTV DDDPRAESSD DDSPRSGEPK DGSFDEEKQH ATSRMPALAS DYLQPYSQLE  120
LNQPMASAAY PYPDAYYTGM VGPYGAQAVA HFQLPGLTHP RMPLPLEVSE EPVYVNAKQY  180
HGILRRRQSR AKAELERKAI KARKPYLHES RHQHAMRRAR GTGGRFLNTK KDESGGASNG  240
GRTEASKGEQ SSEYLRVPPD LHLRQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-21170234266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3541160.0AK354116.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1005C04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560983.11e-149PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_010231280.11e-149PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752975.11e-149PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752976.11e-149PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLA0A096URN20.0A0A096URN2_WHEAT; Uncharacterized protein
STRINGBRADI1G11800.11e-149(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82053649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-36nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]